PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G042900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 217aa    MW: 23701.1 Da    PI: 7.1631
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G042900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.2e-42601591100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA+ar+rdP+yG++g i +lq+q+++l
  Manes.10G042900.1.p  60 PCAACKILRRRCAEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKFLQEIPESHRADAVSSMVYEANARIRDPIYGCAGAICQLQKQVNEL 149
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+l+++++e
  Manes.10G042900.1.p 150 QAQLVTAQAE 159
                          *****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.80359160IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4260157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGNLDKAVAV SSPFSYSPPS FSSSSSSISP SSQSSPTLPP PPPPPHPSPH PSTPCVVLSP  60
CAACKILRRR CAEKCVLAPY FPPTEPYKFT IAHRVFGASN IIKFLQEIPE SHRADAVSSM  120
VYEANARIRD PIYGCAGAIC QLQKQVNELQ AQLVTAQAEV VNMKSQQANL VALICMEKMT  180
QSHHLQEPIF QHHQYVDTSC FLDETNLGTP WEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.12e-99PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HLY24e-98B9HLY2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04350.11e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-73LOB domain-containing protein 1